SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657303|ref|YP_008143665.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657303|ref|YP_008143665.1|
Domain Number 1 Region: 455-1215
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 3.46e-249
Family FMN-linked oxidoreductases 0.00000000000463
Further Details:      
 
Domain Number 2 Region: 30-443
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 3.69e-137
Family Class II glutamine amidotransferases 0.0000000245
Further Details:      
 
Domain Number 3 Region: 1231-1494
Classification Level Classification E-value
Superfamily Alpha subunit of glutamate synthase, C-terminal domain 2.35e-85
Family Alpha subunit of glutamate synthase, C-terminal domain 0.000000868
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657303|ref|YP_008143665.1|
Sequence length 1525
Comment glutamate synthase, large subunit [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MIAVTFASPLDLTIHRPEGMYDPAAEHDACGVGMVTTLNTRPERKIVDDAIEVLINLNHR
GAVGAEENTGDGAGILMSMPDEFMRAVIDAPLPDPKHYAAGIAFLDRDIATSGQQEQAIA
KIATEEGLEVLAWRVVPTNPDGLGLQALASMPSFKMLVLADPQSALAGVDLDRKVYRVRK
RAEHEVGVYFASLSSMTITYKGMLTTMQLKPFFPDLFDERMKATIAIVHSRFSTNTFPSW
PLAQPFRLIAHNGEINTIQGNRNWFSAREGRLSSKLLGDMKELLPILTPGYSDSGTFDEV
LELLHLAGRSLPHAILMMVPPAWENNKELDPDVRAFYEYNNTLIEPWDGPADIVFTDGEL
VGALLDRNGFRPGRWQITDDGYVVLASESGVLPQVGEEHIVRKGRLEPGKMFLIDTARGE
VIEDDVIKHELATAHPYREWVEDNTVEMKELPQRQHINYSGRSVHRRQRAFGYTQEELKM
VLTPMANTGKEPLGSMGNDIPLSVLSSRSRMLFDYFMQKFAQVTNPPLDWEREKIVTSIA
SAIGPEPNLLEDCALHAKKVIIPQPVLTSDEMAQLKRLDRASQLGGYYKPYVIRGLYQVT
GGGNALETRLEEIFAEIDQAIADGSNFLVLSDRDSNHMMAPIPSLLLTSAVQHHLLRKHT
RTQISMVVEAGDVREIHHVALLIAYGAAAVNPYLAFESVEELSRTGYVTVDPETAIENLR
NALSTGVLKIMSKMGVSTIMSYRGAQLFEAVGLDSAVIDKYFTGTVSRVEGCGLDDLAEE
VAIRHREAYPNQWTATPHRVLRTGGEYKWRRTGEEHLNDPEAIFLLQQSTQRGDYDMFKR
YSAHINDTSNRLMTLRGLMKFNAVRKPIDISEVEPATEIVKRFSTGAMSYGSISKEAHET
LAIAMNSIGARSNSGEGGESTERLNDPKLCSKIKQIASARFGVTSDYLVHATDLQIKLAQ
GAKPGEGGHLPGAKVPPWIAKVRHATPGVELISPPPHHDIYSIEDLKQLINDAKMANPKA
RVHVKLVSEFGVGTIAAGVAKCHADVVLISGYDGGTGAAPLNAIRHAGTPWEIGLSETQQ
TLILNGLRSRIVVQCDGELKTGRDVVIAALLGAEEFGFATTALMVEGCVMMRACQKNTCP
QGIATQDPELRARFTGKPEHVVNFMMFIAEEVRELLAQLGFRTLEEAVGHVECLDQNDAI
ERWKSAGIDLSHVLMQSGPVPGTVLHQTIEQNHELDTALDNVLIEQAHDALENGTPVRIT
ADIRNVNRTVGTMLGYEITRRYGEDGLPDNTIDLTLNGTGGQSIGAFIPRGETIRIVGET
NDYAGKGLSGGRMVIRPTDAITFDPHTNVIAGNVLGFGATSGEMFVAGRAGERFGVRNGG
ATFVVEGVGDHGCEYMTGGTVVILGSTGRNLGAGFSGGHVYVLDLDRDKLNPQAASGALQ
IEPLDEHASAVVRELVERHAAETGSVFAKELLEHWSESAKRFTHLVPKQFVAMTAAMDKA
KAEHIDFNEPGVWEETYEHVMEGAR
Download sequence
Identical sequences gi|518657303|ref|YP_008143665.1| gi|452892221|ref|YP_005579663.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]