SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657385|ref|YP_008143747.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657385|ref|YP_008143747.1|
Domain Number 1 Region: 35-241
Classification Level Classification E-value
Superfamily CheY-like 1.71e-50
Family CheY-related 0.0000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657385|ref|YP_008143747.1|
Sequence length 252
Comment two-component system response regulator [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MSNEEQESITEEPTVDNAADAIEVADAQVAKKEAKRNPTVVVAEDESVNRMDLVAMLEDN
GYEVVGEAANGEEAIELTREKRPDVVCMDVKMPHMDGITAAGVICDENLAPVVMLTAFSQ
ADLVKEAIGAGAMAYVTKPYEESKLLPALAVAMGRFAEINDLLDSVERNESELRTTQEQL
RDAEEELRKTKETLEERKLIDRAKGLLMDKANFSESGAFRWIQKTSMDQRIPKKRLAQAI
IEKYSDKPNDGE
Download sequence
Identical sequences B8DUU5 D3R5H3
gi|549472453|ref|YP_008606160.1| gi|219683967|ref|YP_002470350.1| 442563.BLA_1492 555970.Balat_0981 580050.Balac_0981 gi|387820875|ref|YP_006300918.1| gi|384195567|ref|YP_005581312.1| gi|518657385|ref|YP_008143747.1| WP_004217756.1.14456 WP_004217756.1.16162 WP_004217756.1.20477 WP_004217756.1.21588 WP_004217756.1.22654 WP_004217756.1.23267 WP_004217756.1.23846 WP_004217756.1.23969 WP_004217756.1.26294 WP_004217756.1.34099 WP_004217756.1.38287 WP_004217756.1.38998 WP_004217756.1.45260 WP_004217756.1.45775 WP_004217756.1.47471 WP_004217756.1.47549 WP_004217756.1.50484 WP_004217756.1.53490 WP_004217756.1.62237 WP_004217756.1.66072 WP_004217756.1.75174 WP_004217756.1.78909 WP_004217756.1.86686 WP_004217756.1.86797 WP_004217756.1.94304 gi|387822550|ref|YP_006302499.1| gi|384192405|ref|YP_005578152.1| gi|384191259|ref|YP_005577007.1| gi|241191009|ref|YP_002968403.1| gi|384194001|ref|YP_005579747.1| gi|241196415|ref|YP_002969970.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]