SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657453|ref|YP_008143815.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657453|ref|YP_008143815.1|
Domain Number 1 Region: 7-140
Classification Level Classification E-value
Superfamily CheY-like 7.12e-32
Family CheY-related 0.00029
Further Details:      
 
Domain Number 2 Region: 165-233
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 8.16e-23
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657453|ref|YP_008143815.1|
Sequence length 234
Comment response regulator of two-component system [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MADASRIRMVIADDQELVRAGFTMVINSQPDMQVVGQASDGTQAVQLVERLHPDIVLMDV
RMPSMDGLAATAQITSHADGEQHTRVIILTTFDLDEYVMSAINAGASGFLLKDTEPETLL
NSIRTVHQGNAIIAPTATKRLIEKMMETGVTQEGPGRQQSEVAAEYTDPELATLTERERE
VLIEIAHGLSNQEIADKLFISLPTVKTHVAHILQKINARDRVQAVVFAYENHLV
Download sequence
Identical sequences B8DTF1 D3R5P8
gi|452892234|ref|YP_005579821.2| gi|518657453|ref|YP_008143815.1| gi|384192479|ref|YP_005578226.1| gi|384191334|ref|YP_005577082.1| 442563.BLA_0990 gi|219683473|ref|YP_002469856.1| WP_004269122.1.14456 WP_004269122.1.20477 WP_004269122.1.22654 WP_004269122.1.23267 WP_004269122.1.23846 WP_004269122.1.23969 WP_004269122.1.26294 WP_004269122.1.34099 WP_004269122.1.38287 WP_004269122.1.38998 WP_004269122.1.45260 WP_004269122.1.45775 WP_004269122.1.47471 WP_004269122.1.47549 WP_004269122.1.50484 WP_004269122.1.53490 WP_004269122.1.62237 WP_004269122.1.66072 WP_004269122.1.75174 WP_004269122.1.78909 WP_004269122.1.86686 WP_004269122.1.86797 WP_004269122.1.94304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]