SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657469|ref|YP_008143831.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657469|ref|YP_008143831.1|
Domain Number 1 Region: 62-419
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.01e-65
Family Extended AAA-ATPase domain 0.0000000368
Further Details:      
 
Domain Number 2 Region: 13-47
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.0000000171
Family ClpX chaperone zinc binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657469|ref|YP_008143831.1|
Sequence length 442
Comment ATP-dependent Clp protease, ATP-binding subunit clpX [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MGRVVSYNDGVQRCTFCGKSEHEVHRLVAGAGVAICDECIGLCVQILSEENAKDSRLEVL
KLPKPSQIRDVLDQYVIGQNDAKRTLSVAVYNHFKRAQIERHDANAHRQFEQSRLADSTR
SILDPLDEVSVAKSNILLLGPTGVGKTYLAQTLAKAMQVPFIIVDATSITEAGYVGDDVE
MVLSRLLQAADGDVDRARHGIVYIDEVDKIARKSGDNTSMTRDVSGEGVQQALLKILEGT
LVHVPVDGAHRHKDGETVELDTSDILFICGGAFVGLDEIVSRRLGRHESGFGASWRVNPI
DEHEIYRQVNADDLAEFGLLPEFIGRLPVVCTLGELTVDDLKDVLTKPTNALLKQYQKLF
SVDGVTLTFTDAAVEAIASTALERGVGARGLRSIIESILEETMFELPNMDDVTEVVVNAD
CVTEGVPPQMVRPERRRVIHAL
Download sequence
Identical sequences A0A2G9IPR7 B8DTD5
gi|387820966|ref|YP_006301009.1| gi|384195658|ref|YP_005581403.1| gi|219683457|ref|YP_002469840.1| gi|384194092|ref|YP_005579838.1| gi|518657469|ref|YP_008143831.1| WP_004217641.1.14456 WP_004217641.1.16162 WP_004217641.1.20477 WP_004217641.1.21588 WP_004217641.1.22654 WP_004217641.1.23267 WP_004217641.1.23846 WP_004217641.1.23969 WP_004217641.1.26294 WP_004217641.1.34099 WP_004217641.1.38287 WP_004217641.1.38998 WP_004217641.1.45260 WP_004217641.1.45775 WP_004217641.1.47471 WP_004217641.1.47549 WP_004217641.1.50484 WP_004217641.1.53490 WP_004217641.1.62237 WP_004217641.1.66072 WP_004217641.1.75174 WP_004217641.1.78909 WP_004217641.1.86686 WP_004217641.1.86797 WP_004217641.1.94304 gi|241191100|ref|YP_002968494.1| gi|549472544|ref|YP_008606251.1| 442563.BLA_0974 555970.Balat_1076 580050.Balac_1076 gi|387822644|ref|YP_006302593.1| gi|241196506|ref|YP_002970061.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]