SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657479|ref|YP_008143841.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657479|ref|YP_008143841.1|
Domain Number 1 Region: 12-198,299-383
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 3.14e-69
Family Bacterial dinuclear zinc exopeptidases 0.00000643
Further Details:      
 
Domain Number 2 Region: 183-289
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 2.99e-26
Family Bacterial exopeptidase dimerisation domain 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518657479|ref|YP_008143841.1|
Sequence length 387
Comment N-acyl-L-amino acid amidohydrolase [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MTDHTEHVEIALTDELLGIRRRLHRHPERSFKEFETSMRLRNLLESHGITVLDNPLDTGV
IGEIKGEHDGPQIGLRADIDALPVHEDSGLVFASENEGVMHACGHDIHMTSLLGAAFWLA
AHRELIHGTIRLVFQPAEELGQGARAVADAGLVDGLDAMIGTHNNPDYKPGQIAVGVDPM
MAGCVKFRVNLHAQGTHAGYPHRGTGPLEAMAAMVLSLQTIVSRNASPFHPLVISVTEVH
GGDVWNVVPAEAGFQGTARYFHREDGDLAERRFRQVIESTAAAYDIAVDYVWDDFQRPLV
SDPDLATLAMSHVPEYAQLEPIHPSMAGEDFAEYEGHTRLLFAFIGSNGSGGCADLHSPK
FVALDDAVKTGAEFYANSALEVLEHLS
Download sequence
Identical sequences A0A2G9IPS7 B8DTC5
WP_004217628.1.14456 WP_004217628.1.16162 WP_004217628.1.20477 WP_004217628.1.21588 WP_004217628.1.22654 WP_004217628.1.23267 WP_004217628.1.23846 WP_004217628.1.26294 WP_004217628.1.34099 WP_004217628.1.38287 WP_004217628.1.38998 WP_004217628.1.45260 WP_004217628.1.45775 WP_004217628.1.47471 WP_004217628.1.47549 WP_004217628.1.50484 WP_004217628.1.53490 WP_004217628.1.62237 WP_004217628.1.66072 WP_004217628.1.75174 WP_004217628.1.78909 WP_004217628.1.86686 WP_004217628.1.86797 WP_004217628.1.94304 gi|219683447|ref|YP_002469830.1| gi|387820976|ref|YP_006301019.1| gi|241191110|ref|YP_002968504.1| gi|384195668|ref|YP_005581413.1| gi|384194102|ref|YP_005579848.1| gi|549472554|ref|YP_008606261.1| 442563.BLA_0964 555970.Balat_1086 580050.Balac_1086 gi|241196516|ref|YP_002970071.1| gi|387822654|ref|YP_006302603.1| gi|518657479|ref|YP_008143841.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]