SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657520|ref|YP_008143882.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657520|ref|YP_008143882.1|
Domain Number 1 Region: 1-116
Classification Level Classification E-value
Superfamily CheY-like 3.13e-24
Family CheY-related 0.0013
Further Details:      
 
Domain Number 2 Region: 139-203
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 6.12e-17
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657520|ref|YP_008143882.1|
Sequence length 218
Comment two-component system response regulator [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MKVAIVDDDPIVCSSIGTILTTTGTAEVVWTAHDGAAAVVAYARQKPDVLLIDVQMPGTD
GLEASERILVLTTFADPEYIRRAIELGTKGYLIKQDVASVIPAVQAVMAGQVVLGADVLR
NLPMHDASGNVEEPKASPLPDDPRFAHLTDREHDIVELVAEELDNREIAAKLFLSEGTVR
NRISGILAKTHISNRTKLAIEWLTSHDRHIHDHHIEVR
Download sequence
Identical sequences B8DT82 D3R5X1
gi|384191407|ref|YP_005577155.1| gi|384195711|ref|YP_005581456.1| gi|518657520|ref|YP_008143882.1| gi|384192553|ref|YP_005578300.1| 442563.BLA_0919 555970.Balat_1128 580050.Balac_1128 gi|219683404|ref|YP_002469787.1| gi|387821018|ref|YP_006301061.1| gi|241191152|ref|YP_002968546.1| gi|384194146|ref|YP_005579892.1| gi|241196558|ref|YP_002970113.1| WP_004217574.1.14456 WP_004217574.1.20477 WP_004217574.1.22654 WP_004217574.1.23267 WP_004217574.1.23846 WP_004217574.1.23969 WP_004217574.1.26294 WP_004217574.1.34099 WP_004217574.1.38287 WP_004217574.1.38998 WP_004217574.1.45260 WP_004217574.1.45775 WP_004217574.1.47471 WP_004217574.1.47549 WP_004217574.1.50484 WP_004217574.1.53490 WP_004217574.1.62237 WP_004217574.1.66072 WP_004217574.1.75174 WP_004217574.1.78909 WP_004217574.1.86686 WP_004217574.1.86797 WP_004217574.1.94304 gi|387822696|ref|YP_006302645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]