SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657563|ref|YP_008143925.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657563|ref|YP_008143925.1|
Domain Number 1 Region: 137-207
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 0.0000000000000034
Family GerE-like (LuxR/UhpA family of transcriptional regulators) 0.0059
Further Details:      
 
Domain Number 2 Region: 18-103
Classification Level Classification E-value
Superfamily CheY-like 0.00000000000413
Family CheY-related 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657563|ref|YP_008143925.1|
Sequence length 207
Comment two-component system response regulator [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MTTKTSEATDRHGRYTLGIVDNDPLVAEAPRSSFERFHAPLEVIWALTDPEDALVHCLHA
KGRPDVLLTDIDMPRLSGLGLFHELQTRKLPITVIGISAFPNIAEEPGLVILPKESAVEE
IVQLAGMLRRDDDLTRWFPTPTKPNPLSPSELHALTHYSEGLTTTAIAHTMHVSESSMKT
FAKRAYEKLDAHSRTEAIAICVRNGWI
Download sequence
Identical sequences A0A2G9IQ23 B8DSR3
gi|241196601|ref|YP_002970156.1| gi|241191195|ref|YP_002968589.1| gi|219683235|ref|YP_002469618.1| gi|384195757|ref|YP_005581502.1| gi|384194192|ref|YP_005579938.1| 442563.BLA_0749 555970.Balat_1171 580050.Balac_1171 gi|387822740|ref|YP_006302689.1| gi|387821061|ref|YP_006301104.1| gi|518657563|ref|YP_008143925.1| WP_004218684.1.14456 WP_004218684.1.20477 WP_004218684.1.22654 WP_004218684.1.23267 WP_004218684.1.23846 WP_004218684.1.23969 WP_004218684.1.26294 WP_004218684.1.34099 WP_004218684.1.38287 WP_004218684.1.38998 WP_004218684.1.45260 WP_004218684.1.45775 WP_004218684.1.47471 WP_004218684.1.47549 WP_004218684.1.50484 WP_004218684.1.53490 WP_004218684.1.62237 WP_004218684.1.66072 WP_004218684.1.75174 WP_004218684.1.78909 WP_004218684.1.86686 WP_004218684.1.86797 WP_004218684.1.94304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]