SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657840|ref|YP_008144202.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657840|ref|YP_008144202.1|
Domain Number 1 Region: 149-248
Classification Level Classification E-value
Superfamily C-terminal effector domain of the bipartite response regulators 2.27e-30
Family PhoB-like 0.00073
Further Details:      
 
Weak hits

Sequence:  gi|518657840|ref|YP_008144202.1|
Domain Number - Region: 57-136
Classification Level Classification E-value
Superfamily CheY-like 0.0273
Family CheY-related 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|518657840|ref|YP_008144202.1|
Sequence length 273
Comment Transcriptional regulatory protein [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MRTSLLHKHGTQQERIGNVTDLTLMTFSTDPTTVLPSLTLLSHRVRVLPMDASSLVRMPE
NTILLLDARDDLASAKTLCRLLHASGLSTPIVLILTEGGFTVVNGEWGVSDVIVNTASPA
EVEGRLRLVTERVATYNVMPNALANSGPEDEDGLIRSGDLVVDTNGYTANLRGVPIDLAY
KEFELLKYLVQHPGRVFTRAQLLQEVWGYDYYGGTRTVDVHVRRLRAKLGGEYEHLIGTV
RNVGYRFDPPEEESANNTAREAAEMGSPTSADE
Download sequence
Identical sequences gi|518657840|ref|YP_008144202.1| gi|452892265|ref|YP_005580217.2|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]