SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518657903|ref|YP_008144265.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518657903|ref|YP_008144265.1|
Domain Number 1 Region: 13-222
Classification Level Classification E-value
Superfamily N-terminal nucleophile aminohydrolases (Ntn hydrolases) 0.0000000000000011
Family Class II glutamine amidotransferases 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518657903|ref|YP_008144265.1|
Sequence length 300
Comment glutamine amidotransferase, class-II [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MGNMRTLHSTTMCRLLGYATANENISLREVLGAQSTDAFRELSEIHNDGWGTAMVKEPDQ
TAHVTDGGAPSPSTGSAIYRNTIAARYDSIFGDLASVPVRGGIWHLRLASSNLPLVLENQ
QPFYASGLSFIHNGDISDAQGRNITTNRAYPVDHTLVQSTGGRSDSAIYFAIVLQYLGYG
YELEEALAQAVRELRGAYPDSSYNCIIQSRDQLIVLEAHDNGPTQQDVLDVYAQYGRAAE
AADYRTVRYREITGADGARKGVVAASSGFAQPADEGWKDLGNNRMIVASNRTGAFRVRSI
Download sequence
Identical sequences D3R735
gi|384190179|ref|YP_005575927.1| WP_004219238.1.23969 gi|384196105|ref|YP_005581850.1| gi|241191544|ref|YP_002968938.1| gi|241196949|ref|YP_002970504.1| gi|518657903|ref|YP_008144265.1| 555970.Balat_1534 580050.Balac_1534 gi|384192970|ref|YP_005578717.1| gi|384194535|ref|YP_005580281.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]