SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|518656709|ref|YP_008143071.1| from Bifidobacterium animalis subsp. lactis Bl12

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|518656709|ref|YP_008143071.1|
Domain Number 1 Region: 330-432
Classification Level Classification E-value
Superfamily TPR-like 0.000000000237
Family Tetratricopeptide repeat (TPR) 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|518656709|ref|YP_008143071.1|
Sequence length 550
Comment hypothetical protein Bl12_0240 [Bifidobacterium animalis subsp. lactis Bl12]
Sequence
MAEQESALDFIEATHLWSQHAQFVGRAEGAPNPFRTIYGVEAQPGGVWDVMTRFHTICER
LQLPFHVSTSVEVNPATGDMAVAFGAPEPTQFPTAVPDSHGRARDCTGKRAQWTAAYALR
LAALLANIGFAVNTGIIGVTVIARAGEPDGQTLFSLGFNRVDFHFTTAKLFADGTIDDAQ
FDVDPAQLLAAFDVDSARVEFDADGWFAPTEDPELPESLCELRTPLGEDARELPDSLKSL
LRADRVCDLDIADQASLSIRDIHQIAQENADSPVTAVVELGGALTTLKQELSVSTSIRQP
LYCEREALRLLVSEAAGDAATRYRTVPGAIAAVRSELARFDMKLGQLDDALRELQELQRI
SPTSVQGGIAEAMAYSMAGDTARAVDAIRQALKLAVVPDEVAFLYCLLGQMFAMAGETDT
AIDAYYVASTVAAQTAYTGVARQAMEALLAQIGSADDDGERDERSFTATVDARPTAPSRG
HALGSLQAAGIPISPTQPVIQTLTRAAMLLADAGVPLAAYDGVEILAEYSAEPTLLWMCR
ALQEGAGCAR
Download sequence
Identical sequences A0A2G9IS04 B8DVP6
gi|387821841|ref|YP_006301790.1| gi|549471761|ref|YP_008605468.1| 442563.BLA_0245 555970.Balat_0257 580050.Balac_0257 gi|384193317|ref|YP_005579063.1| WP_004268340.1.14456 WP_004268340.1.16162 WP_004268340.1.20477 WP_004268340.1.21588 WP_004268340.1.22654 WP_004268340.1.23267 WP_004268340.1.23846 WP_004268340.1.23969 WP_004268340.1.26294 WP_004268340.1.34099 WP_004268340.1.38287 WP_004268340.1.38998 WP_004268340.1.45260 WP_004268340.1.45775 WP_004268340.1.47471 WP_004268340.1.47549 WP_004268340.1.50484 WP_004268340.1.53490 WP_004268340.1.62237 WP_004268340.1.66072 WP_004268340.1.75174 WP_004268340.1.78909 WP_004268340.1.86686 WP_004268340.1.86797 WP_004268340.1.94304 gi|384194872|ref|YP_005580617.1| gi|241190316|ref|YP_002967710.1| gi|241195722|ref|YP_002969277.1| gi|387820180|ref|YP_006300223.1| gi|518656709|ref|YP_008143071.1| gi|219682740|ref|YP_002469123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]