SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|100797|estExt_Genewise1.C_3_t50125 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|100797|estExt_Genewise1.C_3_t50125
Domain Number 1 Region: 18-68
Classification Level Classification E-value
Superfamily Zn2/Cys6 DNA-binding domain 0.000000000012
Family Zn2/Cys6 DNA-binding domain 0.0015
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|100797|estExt_Genewise1.C_3_t50125
Domain Number - Region: 512-541
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 0.0379
Family Surp module (SWAP domain) 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|100797|estExt_Genewise1.C_3_t50125
Sequence length 1039
Sequence
MSSAEDDYNDHDGGHGGSKKRRVQRACDICRRKKIRCDGGQMPGNRCSNCIAYNFECSYV
EAAKKRGPPKGYVENLENRLEKMEKLLSKVCPDADFSQELGGRPIKKDAWLKNNDPQSSS
MSAATAGHTSPTSATSRHGRAAANGGQTTPLEDLVSSDDEVDMLELKLTESIRKMAIDPM
RHRFFGKSSGVTLIQKAIDLKNEYTGDQINSMDFFSRRRPEFDVCHPWEIAGKKIDEPTY
IFPEADLARELIDLYFKYSNPMAPLLHHPTFERKYADALHLRDSAFGSVVLLVCAVAARW
CEDQRVLLPDTESEHSAGWKYFEQVQMVRKTLLGPPCLEDLQVYCLSVLFLQGTSAPQAC
WTIVGIGIRLAQDVGAHRRKVYNNDLTVEDELWKRAFWILVSLDRSLSSALGRPCAIQDE
DFDLDLPVVCDDEYWEHPDPEQAFKQPPDKPSYVAFFISYLKLNQILAFALRTIYSINKS
KVLLGFVGQQWEQHIVAELDSALNKWIDSVPEHLRWDPNNPKFTFLMQSCTLYASYYHTQ
IIIHRPFIPSPRKPSPLSFPSLAICTNAARSCSHVIDGYRKRTGTVPSSVPVGLQVSLST
GAGAGGISAASRLKAESDISPFPLSIAAFTAGIVLLLNIWGGKRSGLAIDPVKEMGDVHK
CMAALKQCENRYHSAGRLWDILYELASVGDLPLPQASPSGMAKRERDEDSPASAIAPVSN
HTTPSSASSHPTPEAQAHGQRHIAGSRRVTRDGGRPSRGGMPQHSPVLATMPARQPHVTS
PSLASSPLPVYSNDLGRLPLHSHGQMSFGAAAPPSPLPPHGHVQSPPRGSSGFDAPSMWF
GAGPGAGGQHSPPSMMTQGGPAGAGSGPGPGASAGAAPHVPYGVDELLYHQMFGGHYSEQ
QAGQPPGQGPSASAAGPGGFGDASMEGLLMGPQAGASGPGGPTSPANQAQGQGAMNGMNG
MGGAPMSGMGGMNGGMNGGMNGMNGMLDADTIAMWSNAPSGFEMDDWGSYISSVSGMNYD
GGAHHQHPHQHQHGHGHGR
Download sequence
Identical sequences jgi|Conpu1|100797|estExt_Genewise1.C_3_t50125 XP_007766252.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]