SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|102642|estExt_Genewise1.C_5_t10413 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|102642|estExt_Genewise1.C_5_t10413
Domain Number 1 Region: 16-138
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 5.23e-23
Family Barwin 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|102642|estExt_Genewise1.C_5_t10413
Sequence length 139
Sequence
MFVSKALALFALALAANAAALPQARSEPSYMHGTQKGDATYYTPGLGACGQTSTSDDLIV
AVSHSLYDTYPGYKGTNPNNNPVCGRKINAHWGGKSVTVKVVDRCTGCAVTDLDFSPAAF
KHLSPLSAGRLHGMTWTWA
Download sequence
Identical sequences XP_007767766.1.51617 jgi|Conpu1|102642|estExt_Genewise1.C_5_t10413

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]