SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|102753|estExt_Genewise1.C_5_t20127 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|102753|estExt_Genewise1.C_5_t20127
Domain Number - Region: 16-88
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0654
Family beta-sandwich domain of Sec23/24 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|102753|estExt_Genewise1.C_5_t20127
Sequence length 147
Sequence
MSAQASSTPTDSPSGSPIQPLHNPSQAAHVSVPQAPVGTQPAPGAPTQQPKPGSAAQALL
AKKMAKTNNPKFVSPTDKMMTPVTQKLNAAKQKRFAKGAKPSGALFTQREGGSGSSDEAT
SDKDADKPTSTEGPSDSKIKHDDDNPF
Download sequence
Identical sequences XP_007767860.1.51617 jgi|Conpu1|102753|estExt_Genewise1.C_5_t20127

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]