SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|103061|estExt_Genewise1.C_5_t20475 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|103061|estExt_Genewise1.C_5_t20475
Domain Number 1 Region: 20-141
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 4.32e-25
Family Ribosomal proteins L15p and L18e 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|103061|estExt_Genewise1.C_5_t20475
Sequence length 186
Sequence
MGIDIKDHHVKKAQRSAPASQDPYLLLLVKLYRFLARRTDSKFNKAVLHRLFLSKINRPP
LSLSRIVKETASTPDRDSKVIVIIGTITDDVRLATVPKLTIAALRFTQAAKERILNAGGE
ILTLDQLAMRAPTGANTVLLRGKRNTREAVKHFGMGPHKHKKPFTASKGRKFERGRGRRK
SRGFKV
Download sequence
Identical sequences jgi|Conpu1|103061|estExt_Genewise1.C_5_t20475 XP_007767943.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]