SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|103859|estExt_Genewise1.C_6_t10002 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|103859|estExt_Genewise1.C_6_t10002
Domain Number - Region: 1441-1532
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.00889
Family Myosin rod fragments 0.0072
Further Details:      
 
Domain Number - Region: 118-223
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.0549
Family Myosin rod fragments 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|103859|estExt_Genewise1.C_6_t10002
Sequence length 1999
Sequence
MVGTRRKSKAAAAAAVALPSDDHDGASTTHTDDSHHAFNVSIPIDVDIDALSNIIPDVSF
SSPTPETIVSVYRILLGQFADADITRRELEEARAEVERKDVELDQAIQDRDGQTKDLEGS
LEEAHGQLEQVKKERDQLATSKNELQTQLSMLTNSQSSSSVELDQYRHRVEDAEREKRDM
ISVVSRLKEDASQRDEEIQTLRLNLKQARQEYQGLETQVRELRSTETSTKFKLDTTTQQL
QLAQKEAERASQELTAKTEDYAQYRRTKHSELAQLQASMDALTQTHASLESSFKALQSSH
SAQSHQLSQALATVQDLKSQIAEQEAAFASEVSGLRRLVGIMEEREKTAKGIVESIEQEW
ARVGDRAEKREAALRAETERERKARGDAEKRADQLEAVLERINRGDLPLPGVNGGAPGTP
GTPGTPVRNVDPMADGMYGLSPTVAMVSKAQRGGKTFTEVYADYVRLQEEFAKKSAEYDH
MDRTLSAVLAQIEERAPILSQQRDEYERLQSEAAQLASQLSSALSERDANASALTEASQK
LKKSADENKLLTDNLNDLGRQVQALLKELGRRSDSSIPDSDEELESLDLPAPQLENDIDA
VITNNLVLFRSIPELQEQNRKLLKVVREMGAKMEAEEREYRDQLDQEQSEAVREAHEAMR
ELAEQLERQKRSAEVTIQAYMKERDALKSMLAREGRGSGVSVGAGVGAAGVGDVVMGNGH
GYGGGANGNGIGDASVELEEVQAQFESYKTEMGIDAGRLREELTAAQREVGGLNASLAKA
NAKIEYLTDRQRMCQEQLSLQSRDLDNLQKRNQQLYDQYTRMDVECHRASDELVTANSRV
EQLRNENANLRAEKRIWEGVQSRLEEENKSLAVERSRLSDLISNVQKMHNDLERSNENDR
RRLEGQVQLLESQAQDLKTQLSQERDAVRHVTLQKDVECKDLQGRLDKTNELLSGTRATL
AGVESTKSHLQERVDFLTRQLQGNEEKLAVYERRGGSGSNGNGDAAARAMDEDLPREQQL
EQEVAELRSALKVAEVDLASARSHMQQFQEISQANEAALSALNTTHDQYKAETEARLVKN
EAEYKALQEKLREAEEELKRTNAKYAELQNAFETERATWANDKKTLEETIVDISSQEKNS
ESDRALKENDFRQLEQRAVAAEERYSREVVTHAESIKVIDGLKQQLSAAQMTARDSSLSA
ANAQAKLESADGSWKQQKEALDKEISDLNARCKDLAAQNTLLHQHLESVSSQAARIRQAA
DSTTAEGQSADDASGDVDTKVSELRSVVAYLRKEKEIVDLQLELSRQENLRLKNQIEHLS
LSLSETRTTLAEERQKALEAATSDSQHAELIERINQLNILRESNATLRADCENYAKRSRE
LDAKVKELSAQLDPVKEEARSAKAELGARAGQISRLEEENRRWQERNQQLLSKYDRIDPA
DMQSLKDEIQALQTQKAEFDSLTAAKDSQIADLSAKVVVAQGEATKHMENMKRNTGIMKR
RLDGFNADKKQLETTVEDLKKQIETLTAEKSAVNAAENSSVEATNALNQQLETLKQEKQT
LEKTLAEERERYAAAAATQQPPQDSTEQTVLIDSLRQERDQLLSEKESWKQGVAPVAETN
GTSEDLVKARDEALAQAKKASEDAQKAQEEVRNIRNSNEKFQMRIQDMQKARERTASEQA
NAVTAAVEKVRNELASSSAPSDDETAKKHAAELEALRVQLVAQHEAKLKEAVDAAVAVAK
AGAPPTDASSQEAIDAAVNARMEEVTAKHNEEITAAVDRGRMEQAAKSKIKDAQLVRSQT
KLKELEAQIAGWREAGLVPEAPASAVPAGKAGPSGTAAKPAGTAAAQSGQATRLAAPIPA
KPVTAQGGVTAPTASSAARATGGGVPLGTAGAAARGRGIARGAGRGTAGRGLSIRGAAPG
RGGAPAAAAGTTSAAGGAAAAPTEGVSIMGAANKRGREDDNTEDSLAKRLRPEGAATAAG
AGAGSNKPPVTLRRPPPAS
Download sequence
Identical sequences jgi|Conpu1|103859|estExt_Genewise1.C_6_t10002 XP_007768341.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]