SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|106160|estExt_Genewise1.C_8_t10220 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|106160|estExt_Genewise1.C_8_t10220
Domain Number 1 Region: 24-98
Classification Level Classification E-value
Superfamily L28p-like 3.73e-20
Family Ribosomal protein L28 0.0022
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|106160|estExt_Genewise1.C_8_t10220
Domain Number - Region: 195-244
Classification Level Classification E-value
Superfamily PSPTO4464-like 0.0981
Family PSPTO4464-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|106160|estExt_Genewise1.C_8_t10220
Sequence length 245
Sequence
MIPTLPNFAAITQRLTQSLPFKRAQQGLFHGKQKLSGNNVPFSLKKTRRTWLPNVQHKRI
PSEALGGVRVKVTTRALRCIEKHGGLDNYLLNTKCELLGIEGMRLRLLVRERAAEQRRVA
HEAKAKEVNEEEKDLRAAQAVVREEKRQQQKLAKRRERESELAVSEGILGSSSNAPSKKA
NVAVEEVPEVQVEVQEDIVSEAKAQTQTQTQEPDVDTAALKEEEENARAERRKQKKQSAS
RGLFD
Download sequence
Identical sequences XP_007769965.1.51617 jgi|Conpu1|106160|estExt_Genewise1.C_8_t10220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]