SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|106848|estExt_Genewise1.C_9_t10103 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|106848|estExt_Genewise1.C_9_t10103
Domain Number 1 Region: 49-144
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.00000000000000133
Family Barwin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|106848|estExt_Genewise1.C_9_t10103
Sequence length 146
Sequence
MRTTYVTTVFALFFAALFGVVSAAHTGPRGAGHKDVIRRSRQTEVAKRDSMRFTYYVVGL
GACGGFSNPGQFVVALNAPEFDQGKSSGNDPCWKMVTIWYGGKSTQAQVVDRCAGCPEGG
LDFSIGLFSFFSTLGAGVLYGNWYYS
Download sequence
Identical sequences XP_007770610.1.51617 jgi|Conpu1|106848|estExt_Genewise1.C_9_t10103

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]