SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|107631|estExt_Genewise1.C_9_t30047 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|107631|estExt_Genewise1.C_9_t30047
Domain Number - Region: 219-245
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000618
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|107631|estExt_Genewise1.C_9_t30047
Sequence length 459
Sequence
MDRYSMTNLTDRYLRGPNKTALGHYPQHDQRRMSEPSVHGPVYNGHSAPAVNIAGSGRYQ
QLQHEFTPVHTSPRSYESYITSNLHRTLSSGDQSGSPWKEEEQPIALPSYTATGFEEPIS
PLNATFSGGEGSPGLTLAGVGAYPTYTDDYGPSPPGTGTSTSSSVLGNRSLADQKSHQHQ
HSGSSGSAGGTPNSKQYSFVALPGNAVRKRPRRRYDEIERLYQCSWPGCTKAYGTLNHLN
AHVTMQKHGSKRSPNEFKELRKQWRKAKKEEAEARALRTAAAQDHFHISRGSFDLQSYDM
HHQQQLQMGRIDRYGQHLAQNGDYHHDQADEYGLPTAREGMFVRRDHFGAFEPSYSSMPG
QQLQYPSADPSNAVLNRLPPDSTLLTPLPGYESNPMANDGSDVYLGGSYELYSNDARPSS
RHDSLNGYPVDRRHSLYSGDSRPRSGHADIRPRDGYGQI
Download sequence
Identical sequences XP_007770987.1.51617 jgi|Conpu1|107631|estExt_Genewise1.C_9_t30047

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]