SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|108225|estExt_Genewise1.C_10_t10474 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|108225|estExt_Genewise1.C_10_t10474
Domain Number 1 Region: 6-146
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 2.75e-39
Family Ribosomal proteins L15p and L18e 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|108225|estExt_Genewise1.C_10_t10474
Sequence length 147
Sequence
MPTRFSQTRKHRGHVSAGHGRVGKHRKHPGGRGLAGGQHHHRTNFDKYHPGYFGKVGMRH
FHLTRNAHWRPIINVDKLWTLVPEEEKKDLTEGSEVVPVIDTLRHGYGKVLGNGQLPKLP
FIVKARFVSSKAEKKIKEAGGVVSLIA
Download sequence
Identical sequences XP_007771418.1.51617 jgi|Conpu1|108225|estExt_Genewise1.C_10_t10474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]