SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|108653|estExt_Genewise1.C_10_t20454 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|108653|estExt_Genewise1.C_10_t20454
Domain Number 1 Region: 4-114,490-596
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.71e-36
Family beta-sandwich domain of Sec23/24 0.0056
Further Details:      
 
Domain Number 2 Region: 232-474
Classification Level Classification E-value
Superfamily vWA-like 4.45e-34
Family Trunk domain of Sec23/24 0.0013
Further Details:      
 
Domain Number 3 Region: 723-859
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 7.32e-26
Family C-terminal, gelsolin-like domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 4 Region: 116-197
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 7.46e-22
Family Zn-finger domain of Sec23/24 0.0018
Further Details:      
 
Domain Number 5 Region: 600-704
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 3.66e-21
Family Helical domain of Sec23/24 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|108653|estExt_Genewise1.C_10_t20454
Sequence length 878
Sequence
MYAFPKPSAGIPQPPHSAGEAYRGLRARIDPSQIPSPVDAIEADRDEWENQTYATLSGKT
PPLSTTDYVALDQGNASPRHLRLTTTHIPASAALARECGIPLGGILQPFADGDPPEEPVP
LVDFGEAGPPRCRGCRAYVSPWAQWTAGGARWRCMLCAEENEVLPEYFCNLDANLQRLDA
LQRPELCRGTVDFRVSSAPAYHTPPALAPFTSDLSTPLYVPPTPPRTTPRAPGPIHMIFA
LDTTADAVNSGFLRAACDALRGALYGGVREDGSEFARCVPREARIGVVSFDRSVAFWELS
PNLREAPMRVVADVDEPFVPVREGLFCDPDESKHVLDALLRDIPGRLANAAAPANQSALG
AAILGGLAALTPTAGHILTFLTSPPTLGPGAMPPASSLLAADEEARVYGTDREKTLFTPR
NEAWRAVAEACKAEGVGVSVWVGGRGVDLGSLGIVPGSTGGDVHLHARFDPARDGRVLED
QVRRALGRTTVYDGEMVVRCSRGLKPTAYTSLYAPSPSSTSALPALSIPYMHADSTLSFG
LAHTGIGVGGSGAAQLDPRGLAHVQAAVLHTTAAGERRVRVVNASAQVAEMAGNVYIWAD
VEGVVCVLARECATQLQTRQVAHIKEDLSDRCASILLGYRRNCAAATSPSQLIIPEAFRA
LPVYTLGITKNKAFKGRTVPADVRNAHAHFLRGASVRSTMQHLYPRVLALHDLDDVIALP
DPDPARGGAVSGWPALMRAGHEWMEAGGVYLADNEKTMIFWIGSSVSPQVMHDLFGVDEP
MAVDPFWTELPVLQTRLSAQVRNILAHRAEQRGYTPRIAFVRQNIDGGEIEFADMLVEDQ
NNGAMSYMDYLCLVHKQISTALTNGGTIGGGAGMRAPW
Download sequence
Identical sequences XP_007771669.1.51617 jgi|Conpu1|108653|estExt_Genewise1.C_10_t20454

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]