SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|109182|estExt_Genewise1.C_11_t20110 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|109182|estExt_Genewise1.C_11_t20110
Domain Number 1 Region: 601-870
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.36e-95
Family BC ATP-binding domain-like 0.000000249
Further Details:      
 
Domain Number 2 Region: 1949-2251
Classification Level Classification E-value
Superfamily Aspartate/ornithine carbamoyltransferase 4.71e-95
Family Aspartate/ornithine carbamoyltransferase 0.000000468
Further Details:      
 
Domain Number 3 Region: 1136-1395
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 3.18e-90
Family BC ATP-binding domain-like 0.0000174
Further Details:      
 
Domain Number 4 Region: 260-452
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.25e-57
Family Class I glutamine amidotransferases (GAT) 0.0000198
Further Details:      
 
Domain Number 5 Region: 865-1017
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 2.88e-52
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0000823
Further Details:      
 
Domain Number 6 Region: 50-197
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, small subunit N-terminal domain 4.71e-49
Family Carbamoyl phosphate synthetase, small subunit N-terminal domain 0.0000598
Further Details:      
 
Domain Number 7 Region: 1020-1137
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.16e-43
Family BC N-terminal domain-like 0.0000239
Further Details:      
 
Domain Number 8 Region: 481-603
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.04e-39
Family BC N-terminal domain-like 0.0000564
Further Details:      
 
Domain Number 9 Region: 1572-1823
Classification Level Classification E-value
Superfamily Metallo-dependent hydrolases 9.64e-32
Family Hydantoinase (dihydropyrimidinase), catalytic domain 0.0067
Further Details:      
 
Domain Number 10 Region: 1403-1542
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 7.98e-26
Family Inosicase 0.044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|109182|estExt_Genewise1.C_11_t20110
Sequence length 2252
Sequence
MSFANGSAAPVITRPSFPRLASNHGRPNGLPAPLATFTPIKDDNSPPATHNAVLELSDGS
SFEGISFGAEGKSVAGECVFQTGMVGYTESLTDPSYEGQILVLTYPLIGNYGVPTRPKSE
DVFPENFESSRIHVAALVVGSYTEDYSHFLADSSLAAWLKENDIPAIFGVDTRALTKRIR
EKGSMLARIMARKSDARSRTVSLDATRTPAGSRPPSPPASTSWREDYTVVPFHDPNQDNL
VAAVSIKKPRVYAARGTPRKHPSGRPLRVVAVDVGMKYNQIRCFVERGVELKVVPWDYDF
TSDPEPYDGLFLSNGPGDPSTIKTTVDRLRGVLEKGDKPVFGICLGHQLLALAAGAKTSK
MKYGNRGHNIPCTDALSGRCYITSQNHGYQVDADTLPAGWKELFRNANDESNEGIYCEDR
PFFSVQFHPESTPGPRDTEFLFDVFIRRVEDCASVGALNAPPLTLPGGRKEDNDKRVPRA
KVQKVLILGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILVNPNIATIATSKGLADKVY
FLPVTPEFVRKIIAYEKPDGIYVTFGGQTALNVGIKLRDEFEGMGVQVLGTPVETIITTE
DRQLFAQAMESIGERCAQSATATTPDEAVSAANAIGFPVIVRAAYALGGLGSGFAQDEAQ
LRALCSKAFATSPQVLVEKSMKGWKEIEYEVVRDCRDNCITVCNMENFDPLGIHTGDSIV
VAPSQTLSDADYNMLRTTAINVIRHLGVVGECNIQYALNPTSREFCIIEVNARLSRSSAL
ASKATGYPLAFIAAKLGLGIPLNEIKNSVTKLTSACFEPSLDYCVVKIPRWDLKKFSRVS
RLLSSSMKSVGEVMAIGRSFEETIQKAIRAIDDSFLGFSNNDFVEDIDEELVNPTDKRIF
AIASAFHRGYSVDKIWQMTNIDKWFLTKLQYVHRMEKQLLNVNISTLRPDLLRSAKQLGF
SDKLIATCLGSTELAVRRLRQEASIAPYVKQIDTVAAEFPAFTNYLYTTYNAVEHDIDFE
DRGVMVLGSGVYRIGSSVEFDWCAVRAIRTLREQGFPTVMVNYNPETVSTDYDEADKLYF
ENISLETILDIYDTERSRGVILSMGGQTPNNIALPLFRQNVKIYGTSPEMIDTAENRFKF
SRLLDEIGVDQPQWKELTSFEEAHTFCNAVGYPVLVRPSYVLSGAAMNVVSTRDDLSNYL
TQATAVSREHPVVITKYIEQAKEIEMDAVAKDGKMIMHFISEHVENAGVHSGDATLIHPP
QDLDPTTVRQIEEATAKIGNALNVTGPFNIQFIAKNNEIKVIECNLRAARSFPFVSKVTG
IDAIEMATKVMLGLPVEPYPDAGMPADYVGVKVPQFSFSRLSGADPVLGVEMASTGEVAC
FGKDKYEAYLKALISTGIVPPEKNILFSVGSYKEKLELLPSVQKLAAAGYNIFATAGTSD
FLTEHNVPCKYLESLDETGGDKLKSEYSLTQHLANNLIDMYINLPSKNNYRRPASYTSKG
YKTRRMAVDFAVPLITNVKNAKMLAEALVRKLPLDVSTIDSKSSHITHTFPGLVNVASFV
PDLTPSGAAAALRDATTASISAGFTASLVLPVGVSGAITDAETLEQVRHIATQNAYCNYA
LSIAATDDNVNSIDEEIRADVKSLFIPFRCGTGSPTKISTVAAHFASWPSDKLIVADAQG
SDLASVLLLASLHNRTVHITDVRSEEDLLLISLSKAKNLKVTCDLSVFLLFFSKEQFPES
SSLVSASVQKTLWKNLDAVDAFSVGATPFRLASELGESASAWSGAEETLPLLLNAVTEGR
LTLDDIRARLHDNPIRIFGLPEQTNTHVEVVVGRRHGLVRKASNWSPLDKTVTGSVHRVV
VHGKTLFLDGTLSSTLPLAKDISSASISHGVADRQTPALVVSKPEFVSPLPPMSHRPSAD
VASQHTLGTSTTLMPQPGNFQTLTPHPAFHRRHILSVKQFTQRDMYDLFSLAHEMRLQVE
RNGTLDILRGKVLCTLFYEPSTRTSASFDAAMKRCGGEVIQVTADTSSVKKGETLADTIR
TVGCYADAIAIRHPDVGSSQHAAKFSPVPVLNCGDGVGEHPTQALLDVYTIRSELGTVNG
KTITLLGDLKNGRTVHSLVTLLCHYSVRLNFVSPSSLAMPASVIAAVRKAGVSVTITESL
EEVLGDTDVLYVTRVQKERFESEQAWMRVRDSYRVDHALLARAKEEMIVMHPLPRVNEID
PEVDFDSRRAVYFRQMRYGLFIRMALLASVMA
Download sequence
Identical sequences XP_007772204.1.51617 jgi|Conpu1|109182|estExt_Genewise1.C_11_t20110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]