SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|110873|estExt_Genewise1.C_14_t10156 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|110873|estExt_Genewise1.C_14_t10156
Domain Number 1 Region: 11-112,142-255
Classification Level Classification E-value
Superfamily Translational machinery components 6.8e-64
Family Ribosomal protein L18 and S11 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|110873|estExt_Genewise1.C_14_t10156
Sequence length 306
Sequence
MPFVKKVKSDAYFSRFQVKYRRRREGKTDYYARKRLVTQAKNKYNAPKYRLVVRFSNKAV
TCQIIYARLQGDFVLCAARSTELPRYGINHGLTNWTAAYATGLLCARRALAKLGLADKYE
GVAEPDGTLQLTEELDDEDAPRPFKCYLDVGLKRTSTGHRVFGAMKGASDGGLFIPHSEK
RFPGYDPESKELDAEVLKKYIFGGHIAEYMESLEEEDDERFKKQFASYLADGVGSDDMEE
IYTNAYAAIREDPSFKPTDKTTDWKAESLKHKTPRRTYEERKAAIQAKIEAFQATGGAMD
EDEDEE
Download sequence
Identical sequences jgi|Conpu1|110873|estExt_Genewise1.C_14_t10156 XP_007773415.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]