SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|111132|estExt_Genewise1.C_14_t10449 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|111132|estExt_Genewise1.C_14_t10449
Domain Number - Region: 126-209
Classification Level Classification E-value
Superfamily Heme-dependent catalase-like 0.0549
Family Heme-dependent catalases 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|111132|estExt_Genewise1.C_14_t10449
Sequence length 266
Sequence
MRNVPPLDPALYHPTPAAHAFLKEQLGLEDNEVLKQHIMKIQQKAYAVAPYPCIRLFAFT
EIDIITYPAYKELLRIGHERLGAIFLEMASCFGQEARKVVADGFPVAQVVLSDLQRELME
LGHEFFQTSPLTFPAHMVPGDAFSPSMLEIRPPAYAPPNTPYPDLNTLSSLNPLSGHVSA
IHASKFFHLFDEAKQKHLARALGGLLSPEPGSIIFGAHVSAKEKGVVKFDVLSSSFDMFC
HSPESWAELWDGDVFRKGTVRVDANI
Download sequence
Identical sequences jgi|Conpu1|111132|estExt_Genewise1.C_14_t10449 XP_007773531.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]