SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|111816|estExt_Genewise1.C_15_t10427 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|111816|estExt_Genewise1.C_15_t10427
Domain Number 1 Region: 5-276
Classification Level Classification E-value
Superfamily ClpP/crotonase 3.95e-62
Family Crotonase-like 0.000000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|111816|estExt_Genewise1.C_15_t10427
Sequence length 284
Sequence
MFTFEGKNIKVSTPSKHVVLVELNRQPVNAFHEEFWTEYSRVFDEISAQTSADIRVVVLS
SALPKIFSAGIDFQSLASTAVRGGDGARVAVSLRDTILKFQYAIAAPERCPYPVIVAVHG
PVYGLGFDIISACDVRYAASDAKFSIKEVDMGLAADIGSLAHLPKVTGNSSLARELALSA
RPFSASEAEKLGLVSNVVEGGKNGVVAAALELAKAIASKSPVAVAGTKRLLIHARDHSVA
ENLEYTATWNSAMLQTSDLAEAVKAGMSKSKEPPNFLHLRRSKL
Download sequence
Identical sequences XP_007773969.1.51617 jgi|Conpu1|111816|estExt_Genewise1.C_15_t10427

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]