SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|112126|estExt_Genewise1.C_16_t10248 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|112126|estExt_Genewise1.C_16_t10248
Domain Number 1 Region: 24-149
Classification Level Classification E-value
Superfamily Translational machinery components 2.09e-36
Family Ribosomal protein L18 and S11 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|112126|estExt_Genewise1.C_16_t10248
Sequence length 151
Sequence
MPPKKVKAPKEENTVSLGPQVAEGELVFGVAHIYASFNDTFVHITDLSGKETISRVTGGM
KVKADRDESSPYAAMLAAQDVAVRCREVGITALHIKLRATGGTGTKTPGPGAQSALRALA
RAGMRIGRIEDVTPIPTDSTRRKGGRRGRRL
Download sequence
Identical sequences XP_007774260.1.51617 jgi|Conpu1|112126|estExt_Genewise1.C_16_t10248

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]