SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|113155|estExt_Genewise1.C_190202 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|113155|estExt_Genewise1.C_190202
Domain Number 1 Region: 19-131
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 1.22e-20
Family Pollen allergen PHL P 1 N-terminal domain 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|113155|estExt_Genewise1.C_190202
Sequence length 132
Sequence
MYAPVFLIALLSALFVSLVASAPISSSTNETSSGLTKRFDNQRMTWYKDGQDACGWSNTP
DQYIVAISESLFGSGENCGKAITIQYGGASATATVADRCEICPEYGLDLSEGLFSFFAPE
HQGVIQAKWWFN
Download sequence
Identical sequences R7SEK6
jgi|Conpu1|113155|estExt_Genewise1.C_190202 XP_007775214.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]