SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|113250|estExt_Genewise1.C_190339 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|113250|estExt_Genewise1.C_190339
Domain Number 1 Region: 26-98
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0000392
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|113250|estExt_Genewise1.C_190339
Sequence length 585
Sequence
MQNIHTWSTNTNTSTARSTRPRNRPSKAQQQQQQQQQPAQAAQPPQTPQVVPPTPAPVVQ
PAYVPQQHYQPQTAAPHATPAPPAPNPPIPPIPTVPQALHTTYSSRLRTGTTLLVQPILS
QRDYAAAAGLGSTFSGRPSRRGGGTVSYVDPGSGDELPDAGALDSDDSDFVASGGTRSAL
RNVGMRSGRLGMSVFHGGGSGSATPQPQGAGGRGAELDQSYLGMIPPARFIKSRPAAPTM
HEYPSPDTIAAAAPTKTALVPIRVEFETDTLRVRDCFVWNLHETLLKPEAFARVFCADLE
LPQTYAETVAAQIRAQLEDAGDVAAIEMEDDDAFRPPLPVESMERGEGGEADVEMVWGEV
MDCRVILSLDVQISNYHLLDHVEWDLRSPLTPESFSQSLCAELGLGGEAVPLIAHAVHEE
LLRHRRDVLDWGVLGGIPDREAVAAAAAAAAAREQTEELGAQPVLPAGAGTTVNGTPQPD
VAVAATAEREKERERKERDKSGLGLLKDKTGLGLGLGWGRAPRDGRGPRALRSVWRDWAE
ADEFRTRFEVLTAEEVERREVERERASRRLRRETSKFQSTRTRRR
Download sequence
Identical sequences R7SES7
jgi|Conpu1|113250|estExt_Genewise1.C_190339 XP_007775272.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]