SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|113263|estExt_Genewise1.C_190355 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|113263|estExt_Genewise1.C_190355
Domain Number 1 Region: 12-254
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.07e-37
Family Eukaryotic type heme oxygenase 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|113263|estExt_Genewise1.C_190355
Sequence length 323
Sequence
MVIAVDYSLSASTLLRESTKRAHESVENTQGAVWLASGKLPKEEYVRFLVMLWHIYDALE
RGLQAHASDPLVSSVWTPLAPVVSRADTIAADIVHLLHLDETSAQTRSWLSHPTVSALLS
SPPPGFTEYINRINRYSDPDSSSSSSFSAPRALAHAYVRYLGDLSGGQIIRQRITKAYAL
DRADGRGIAFYRFGTLESPDAVAGPSDLRRIKEQFRRRLDESVGGDQKVKAVLIEEANLA
FRLNEGLFSALQGPTAEDQDAPKVVYDNTKAPSSSAPLVSVSTVISFIMAASLAHFILVV
TGFTGTAGSVKYKAFEDWLFGGV
Download sequence
Identical sequences R7SEV6
jgi|Conpu1|113263|estExt_Genewise1.C_190355 XP_007775288.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]