SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|113910|estExt_Genewise1.C_240098 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|113910|estExt_Genewise1.C_240098
Domain Number 1 Region: 13-59
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000254
Family Classic zinc finger, C2H2 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|113910|estExt_Genewise1.C_240098
Sequence length 407
Sequence
MAKKKSKQVIRPWCWYCEREFEDEKVLMQHQKAKHFKCNMCPRRLNTAGGLAVHIQQVHK
LEPENLPRIDNALPGRDGYEVEIFGMEGIPAPDVADYKRRKEIELGLAAGSISQPQAKRP
KVENKPLTEDELKARLAAHKALMGIGAANNASQMSPPPDNGGGAVYGAPPQAYAAPPMPA
PGMGMSPPPGMPQPGGMPPPFGFPAGSPPPPGMFPGAPPFPPFLGAPGMPPGPPPPGFPM
PPPGMMPPPGMMMHGGMPGGMPPPGMSGLGPRPPMPPAPSFVPAIGSPGQPMNGILPTST
NGSGTPSQVLPGVSPPPPASVPSTAPPASNVAAAPPPPLILPHPELEQKYAPFKKPTELK
YADPNFSPEEKRARVTKYYYAKDGTATAEAASEETRGKKRARAEDFL
Download sequence
Identical sequences R7SDR7
jgi|Conpu1|113910|estExt_Genewise1.C_240098 XP_007775844.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]