SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|114400|estExt_Genewise1Plus.C_1_t20092 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|114400|estExt_Genewise1Plus.C_1_t20092
Domain Number 1 Region: 504-1232
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 2.88e-242
Family Type II DNA topoisomerase 0.000000000000441
Further Details:      
 
Domain Number 2 Region: 97-331
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 4.32e-63
Family DNA gyrase/MutL, N-terminal domain 0.000000113
Further Details:      
 
Domain Number 3 Region: 322-490
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 3.41e-39
Family DNA gyrase/MutL, second domain 0.0000225
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|114400|estExt_Genewise1Plus.C_1_t20092
Sequence length 1558
Sequence
MSSSEGENFDIDNVSGSESDGYAPAIKKTAKAPAKKATKAAAAKPAAKKAAPKKKVLVDK
DDNADDSIMVSDRDSADGSSPARPVAAPLRKQKTASETYTKLTQLEHILKRPDSYIGSVE
SISQAMWTWDSENKRLVHREVKYVPGFFKIVDEILVNAADNKINDATMDTIKVNIDVEEG
TISVHNNGKGIPIEMHSKEKMYIPELIFGHLLSSSNYDDDEKKLTGGRNGFGAKLANIYS
HEFTIDTADKKTGQKYKQTWTDNMSKVGKAKITKNSRNEEYTKVSFKPDLARFGMDSIDD
DALSLLKRRVYDMAGTVKDVKVFLNDERLKVKNFKQYCDMYLESATTDAAENSGGAAQVK
PTILYEKINDRWEVAFAVSEGSFQQVSFANSIATIKGGTHVNLIADQLAKALITDITKKN
KAASVKPAQIKNHMWIFVNSLIENPTFDSQTKETLTLPSSKFGSRPHLSEEFMKKVSKSA
IVEHVLNWAKFKADQQIKKTDGTKRNRLTGLTKLADANNAGTRKADECTLILTEGDSAKA
LAVAGLGVVGRDNFGVFPLRGKLLNVREAKHDQIMKNEEIQNIKKIMGLQHNKEYSNITS
LRYGKLMIMADQDHDGSHIKGLLINFLDHFYPSLLKIPNFLVEFVTPIVRVSKGKQRKDF
FTIPEYEQWLEDTPDAHKWDSKYFKGLGTSSDADARYYFGNMRKHMIPFAATQDGDRELI
DLAFSKKKADDRKEWLRQFRPGTYLDHNIDEIPYSDFINRELILFSMADNVRSIPSIADG
LKPGQRKVIWGCFKRKLKKEIKVAQLVGYISEVAAYHHGEQSLMATIVNLAQDYVGSNNV
NLLMPNGQFGTRDQGGKDHASARYIFTELSPLTRSLFNPADDPLLTYLKEDNDWIEPEFY
MPTIPLVLVNGADGIGTGWSTTIPCFNPEDIVANLRRLMVGEEMVPMAPWWRGFKGEIKK
TGENKYEVTGIARKVDDTTIEITELPVWEWTQSFKAKLEAMIGDKGEGDVKDYKEHHDNV
NVHFVVTMSAKGMAKAEAQGLVEFFKLSKPMSTTNMICFNFEGKIAKYRAPEEIVEEFYP
KRLAYYQKRKDHLASELQNQFEKLSNQARFVQMIVDKELSVSNRRKEEIIADLRKHNFRP
FPKVVKAKAAGEFEDVVEQPDEDDEVDRAGHVTSTDYDYLLGMAIYSLTKERIQKLLQQA
GEKEKELLALLERTPIGIWNEDLDGFLKAWENSCEDFRNKSLLDANGKPIKRKQTKLQHR
KSVGGRKGSEGSEDEFKPTKAGAKKKAADSKPKSKPVASSSKLESDDDKPVVKKAPAARK
APKKEESDNDISLVAAPKRHMQVNSDSDDDAEVVPAPKRAAAKKPVTKVDSGDEDVSMVV
AAPKRAAARKPAIKIDSDDDDDVSMAPPPPKKKPVTVDSDSEMEAPPSKGKGKAKVDSSS
KRKSPDSGSEGSKPAKKKQASVTDFFGKGATPLEAAAKKAAARKASGSAPASKPAPKPKA
APAKKKKVVESDDDELGGSTSPVRTPPKRAARGKTKTYIEIESESENEDASMFVDDDD
Download sequence
Identical sequences jgi|Conpu1|114400|estExt_Genewise1Plus.C_1_t20092 XP_007763136.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]