SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|114784|estExt_Genewise1Plus.C_1_t30037 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|114784|estExt_Genewise1Plus.C_1_t30037
Domain Number 1 Region: 248-301
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000108
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|114784|estExt_Genewise1Plus.C_1_t30037
Sequence length 350
Sequence
MSDSTEPLFAPFEPFGQEYSKQHQQGLDFASFHSPSDILAPHPDLFELELDSSLAAFNEV
QLQLLTVDSNDAFSFLRSDTPTCGPPSTITQSSESAYESLSSHSESFYNYSDSYAASNCS
FPLDLEMDFQRIRVQSGRSDYGGVAAAQPPSAALTVDPSSFNALPTSPRNSTPAADNAYK
RNSFSDYGGARIPPVPKSSSAEYYGLNYEVRARDATPSSTVSQLPSAAAPQARSVRDAEE
HSSEDLRKRYKCPSCPRSFARAYNLKTHMATHDPNRLKPHVCPHRSCGRSFSRKHDLGRH
LVSIHRDESITSTHSAKSVGVEKSLRGWCDNCGKGWIGKPAECACVAEVK
Download sequence
Identical sequences XP_007763263.1.51617 jgi|Conpu1|114784|estExt_Genewise1Plus.C_1_t30037

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]