SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|115735|estExt_Genewise1Plus.C_1_t50149 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|115735|estExt_Genewise1Plus.C_1_t50149
Domain Number 1 Region: 110-209
Classification Level Classification E-value
Superfamily Mediator hinge subcomplex-like 2.62e-21
Family MED7 hinge region 0.0012
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|115735|estExt_Genewise1Plus.C_1_t50149
Domain Number - Region: 70-100
Classification Level Classification E-value
Superfamily XkdW-like 0.068
Family XkdW-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|115735|estExt_Genewise1Plus.C_1_t50149
Sequence length 255
Sequence
MEEEEAELRNPFPSPPSQYTNYTTRNLNLLEVLKERAAAANVDLEASDQHVLLSDQPSVP
SWSLVQLEKPRVDWILEDGHYSVFGDQWFVKETIPSLADLGGHQLYPVDPSVDRRPSLLA
VLKSALVTYYALTGSMLSPPPPPTSAEPPEWQRHVEWLTILAQNLMAAANDLRPVQARVN
LELMMKRQLELRREETKEIHSRCDVIESQLSALRLNVKQSTTEIHRPKASKTEAGTDKLV
QVTAEDLSQWADEVR
Download sequence
Identical sequences jgi|Conpu1|115735|estExt_Genewise1Plus.C_1_t50149 XP_007763559.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]