SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|115928|estExt_Genewise1Plus.C_1_t50354 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|115928|estExt_Genewise1Plus.C_1_t50354
Domain Number 1 Region: 231-264,296-333
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000799
Family Ubiquitin-related 0.017
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|115928|estExt_Genewise1Plus.C_1_t50354
Domain Number - Region: 17-64
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0994
Family beta-sandwich domain of Sec23/24 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|115928|estExt_Genewise1Plus.C_1_t50354
Sequence length 503
Sequence
MSMMNGTSSGPTTRPAKPPPTGPAPPAPSMAPPAPPIHTQSTHPASRLPQAGPPPPANGS
HVHQHNHAAQKGKKRADAPVDPATMYETLKNRIAALEEEETIEEEEERRFAEEAVKSVRG
LDDSAMHSKYIELFAELKRMERDHSKEKQKLVKDKDAAKGQLTKANQTKTKMENLARELQ
KDNKRLREDSKRLSQCVEDAQDEILQMKNDMAKRADKAKLQDLKYREMPDIVVKVVCRYR
AELFFKISRKTKFGRLFGAWTDRMEFIGKNLRDLKNGSVNGIVRSDSMQIANPKDPSATS
TMQFIFTHNGRSLDGDSTPEEQGVEDGDEILAVELMDLTEGPALEEFPEELPEIKRHKLH
KAWIDNPMEARRTLEEIFDGVVRERLKEVLRQYELRERHFECVIRSKELEVLLSRARAAE
QKQLADGEKKRAEKLDDETQRIRKELEDSQNGQTLLIDKLITCCKEVIRFYQPNAERTQR
LFASLREELERRGAKISESTNGG
Download sequence
Identical sequences XP_007763619.1.51617 jgi|Conpu1|115928|estExt_Genewise1Plus.C_1_t50354

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]