SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|117225|estExt_Genewise1Plus.C_2_t20084 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|117225|estExt_Genewise1Plus.C_2_t20084
Domain Number 1 Region: 5-119
Classification Level Classification E-value
Superfamily L30e-like 1.81e-32
Family L30e/L7ae ribosomal proteins 0.0000108
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|117225|estExt_Genewise1Plus.C_2_t20084
Sequence length 126
Sequence
MAESRGKAWPLADANLTNSILDLVQQAGQYKQLKKGANEATKTLNRGVAEFIVLTADTEP
LEILLHLPLLCEEKNVPYVFVPSKTALGRACNVTRPVIAASVTTSEARELQSQIRTIKLA
IEKLMY
Download sequence
Identical sequences XP_007764594.1.51617 jgi|Conpu1|117225|estExt_Genewise1Plus.C_2_t20084

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]