SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|117304|estExt_Genewise1Plus.C_2_t20171 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|117304|estExt_Genewise1Plus.C_2_t20171
Domain Number 1 Region: 47-147
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.0000000000000119
Family Barwin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|117304|estExt_Genewise1Plus.C_2_t20171
Sequence length 284
Sequence
MHLSSILGLVCLALPFAAGAHNPHWGRRHHHEVARRAPGEVDHYKRDAFSNVRFTFYDVG
LYVRGACGQVNIPTDFIVAINRFQYGSGYPGPLCFKSITIEYGGKQAQATIMDECMGCPY
GALDFSVGLFSFFADQSLGEVYGTWWFNDGSGGGGAPAPTTSSTPAWTPPPSTSSPAWTP
PPSSTWTPPPSSTWTPPPSTSSSSTWTPPPSSTSSSSSSSSASSSSSASSPSVNYSTGAA
SGLAEPTGTAPVDAPSASNPENLLTLNEAIIGIGALAVAGSNAN
Download sequence
Identical sequences jgi|Conpu1|117304|estExt_Genewise1Plus.C_2_t20171 XP_007764617.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]