SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|117951|estExt_Genewise1Plus.C_2_t30385 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|117951|estExt_Genewise1Plus.C_2_t30385
Domain Number 1 Region: 130-201
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 1.31e-20
Family Surp module (SWAP domain) 0.000087
Further Details:      
 
Domain Number 2 Region: 30-96
Classification Level Classification E-value
Superfamily Surp module (SWAP domain) 3.92e-19
Family Surp module (SWAP domain) 0.00029
Further Details:      
 
Domain Number 3 Region: 672-770
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000000000424
Family Ubiquitin-related 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|117951|estExt_Genewise1Plus.C_2_t30385
Sequence length 774
Sequence
MAVEIQAAPIENGLGSTDDVVMQNGTKESSLRFASGLILPPPEIKSVIDRTALFVARSAN
PPQFEDKIRENQRQDPKFSFLNPMDPYHAYYRHRMDRIAAGEEVDEGGSEKAKPATIVEQ
APVVQEDLGLEPPQPQFVIDLPSISPVDLDTMKLTALFTARRGRTFLATLSQREGRNYQF
DFLRPNHSLFGYFNRLVEQYTKVLYPSKDLLDDVKERTRNDAKWKILEHSRQHARWERLK
REKDKKRQDDQEAEKRAFAEIDWHDYAIVQTIEFTAADSNSELPPPMTVLEMENMTLAQK
RMAAMVMETTADDVEAHRARQAAAEADAAAAVGGAGLNGEDGGDTAMEQSDDEEDGEERK
KKEEEDRAREIERARAIQASASAAGPMKIRADYVPKLGAKKGVAHTTCTICGQQIPVDEL
DEHMRIELLDPKWKSQRDALEARRVQASELLRGADVVSSLKNLARTRVDIFGAEADEERR
KKEEEEERNRRREREKVVWDGHTASKVSTMDKYSTNVNFDEQIAAIHRSKGLGPQEINAI
GPGIGPASAPPPAVNSLPPAPSSLPAPPQGAGASNPAYSAATVSSGPQPASAYPPQQPPV
MLPPLHYQGLDAAQPFGYQPPPAGLAQRPPGPPAAASPAQTGTVRSAEEMDDGQEQPAPK
RQKIAKLPGGAVYPEADWIAMHPYTISLHVQLPSDPSKPEWKLDGKVVTVSDLPLNLLVS
TLRERITQASGSQMPVSRIRLSYAGKMLTNSSTIANYNLEDDDQLVLSLTASRR
Download sequence
Identical sequences XP_007764794.1.51617 jgi|Conpu1|117951|estExt_Genewise1Plus.C_2_t30385

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]