SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118101|estExt_Genewise1Plus.C_2_t40076 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118101|estExt_Genewise1Plus.C_2_t40076
Domain Number 1 Region: 11-163
Classification Level Classification E-value
Superfamily Ribosomal proteins L15p and L18e 6.93e-39
Family Ribosomal proteins L15p and L18e 0.00013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118101|estExt_Genewise1Plus.C_2_t40076
Sequence length 239
Sequence
MSARVRISLSNLAPGRNSQHSQKRVGRGQGSGYGGTAGRGHKGAKARSGNGKPKSGFEGG
QTPITKRFPKRGFTNFNDKTYAPINLDRIQHWVEQGRLHSSPEKPITARELLVSGCVHNV
HDGIKLLGDGAAFFKTPIYITPSRASQSAIKAVEGNGGYVFCKYYNPLALQDCVKGRDDR
TSATPTRRSDIVWYTKWRNRAYLSPEALGKMPEGIQQDRWKELSKQLLKFKEQTFDIKK
Download sequence
Identical sequences XP_007764850.1.51617 jgi|Conpu1|118101|estExt_Genewise1Plus.C_2_t40076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]