SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118405|estExt_Genewise1Plus.C_2_t40433 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118405|estExt_Genewise1Plus.C_2_t40433
Domain Number 1 Region: 7-139
Classification Level Classification E-value
Superfamily N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 6.15e-57
Family N-terminal domain of eukaryotic peptide chain release factor subunit 1, ERF1 0.000000805
Further Details:      
 
Domain Number 2 Region: 141-273
Classification Level Classification E-value
Superfamily Translational machinery components 1.13e-48
Family ERF1/Dom34 middle domain-like 0.00000102
Further Details:      
 
Domain Number 3 Region: 275-418
Classification Level Classification E-value
Superfamily L30e-like 1.7e-47
Family ERF1/Dom34 C-terminal domain-like 0.00000356
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118405|estExt_Genewise1Plus.C_2_t40433
Sequence length 437
Sequence
MSQDVAEQNIQMWKVKKLIKSLDAARGAGTSMISLIIPPKDQISRASAMLTQEYGTASNI
KSRVNRLSVLAAITSTQQRLKLYNRVPPNGLVLFVGTILTDEGKEKKVSFDFEPHKPINT
SLYLCDNKFHTEALSELLESDSRFGFIVMDGNGTLFGTLAGNTREVIHKFTVDLPKKHGR
GGQSALRFSRLRDEKRHNYVRKVAELAVQHFITADKVNVNGLVLAGSADFKTELSQSDMF
DLRLAAKVIKVVDVSYGGENGFNQAIELASESLANVKFVQEKKLIQKYFDEISQDTGRYC
FGIDDTLKALELGAVETLIVWENMDITRYILRNAAGEEIVIHANKEQEKDREKFTDKSTG
LEMEQLAEPQPLLEWFAEKYKEFGAALEFVTNRSQEGAQFVKGFGGIGGLLRYKVDLSNL
ASVDDEEDEFYSDDDDI
Download sequence
Identical sequences jgi|Conpu1|118405|estExt_Genewise1Plus.C_2_t40433 XP_007764979.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]