SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118575|estExt_Genewise1Plus.C_2_t50132 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118575|estExt_Genewise1Plus.C_2_t50132
Domain Number 1 Region: 15-196,237-329
Classification Level Classification E-value
Superfamily Ribokinase-like 3.87e-73
Family Thiamin biosynthesis kinases 0.00000186
Further Details:      
 
Domain Number 2 Region: 336-555
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.34e-57
Family TENA/THI-4 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118575|estExt_Genewise1Plus.C_2_t50132
Sequence length 559
Sequence
MVHHEHTSNSKCLVALTIAGSDSSGGAGIQADLKTFAAHGCYGTSVLTALTAQNTMGVQG
VHGVPPEFVEQQIRSVMDDTEVSAIKTGMLFDTKNTLAVAKTLESIFSSHGHVPLVVDPV
CVSTSGHILLETDAIETLINELFPLACIITPNLSEAGVLLSRRGFSSKVEKLGEMVQGAK
DLLELGSQAVLLKGGHVTVRLSDLETARAEDPSIAVISDDSFSDDVEILRVSERDPNGVD
FVVDVLCQIDGGVTLFPRPRLDSTSTHGTGCTLSAAIACELARGRQLLDAVRYATAYTHL
GIETAPPIGKGHGPLNHAHPVLLRPLSIRTAGNPHPLTRLCIQSTAVLWKQYVQHDFVRL
LGKGTLPRESFLHFIKQDYLYLKYYARAYAMLAAKSHDFALIKSSSDVLLSIITESSMHA
SFCKQWGVSDEELRTAPESPATTAYGASLIDTGLRGDTMALTMSLAACLLGYGEVGLWLK
REASKPGSWVNWESNPYLRWMEDYSGKEYQDAVRIGIESIESRAAADPPSEVRLEEWKSV
WERCVRLEKGFWDMAMTLS
Download sequence
Identical sequences XP_007765063.1.51617 jgi|Conpu1|118575|estExt_Genewise1Plus.C_2_t50132

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]