SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118653|estExt_Genewise1Plus.C_2_t50225 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118653|estExt_Genewise1Plus.C_2_t50225
Domain Number 1 Region: 20-171
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.00000000000000392
Family Osmotin, thaumatin-like protein 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118653|estExt_Genewise1Plus.C_2_t50225
Sequence length 186
Sequence
MKFSLALTAAALFASASAFTIKFDNKCSYAVWPAIGKAPNGQPDPSVAHGAKLAAGKSIS
WSVADTQIGIRAWGRTGCADNGTGCKTGGCNGGMVCTDGGITAGVILSEYGYADFGAQYG
GKRISWDLSHVDSSINLATGLHASDGQSVRCASGNCPANQAYNSATDYAADRNSPLGATF
THTFCA
Download sequence
Identical sequences jgi|Conpu1|118653|estExt_Genewise1Plus.C_2_t50225 XP_007765094.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]