SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|118852|estExt_Genewise1Plus.C_2_t60043 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|118852|estExt_Genewise1Plus.C_2_t60043
Domain Number 1 Region: 44-88
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000192
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|118852|estExt_Genewise1Plus.C_2_t60043
Sequence length 522
Sequence
MAAVLAPNQPTILPTAAIGGVNKRYRPAPAKTFQCRGYGECRMVFSRSEHLARHIRKHTG
ERPFTCHCGKQFSRLDNLRQHAQTVHADKQDQNDRMMRDLTTLHASMAAANKSTQTRGKQ
RPNQSPTQSSMLPASHHSTTANEHGLRGLDQVKEEDDMSSSSLPMHQRPGTSTGYEGGND
MMYQSSWNTGDFDRGPGHSHPRPPNNHSFRDSSQSFRVPPASTSSTIGQQSQSFLPFSNT
FSFSVPPRDGRPGSSHSRPPTTGGLDQNARTLPPLSAVVSATVAPPPSAQQPFPLPPQST
QHILPLSGASAFTRRPSTATRPGTAPASYFGSKPAYAGGPGLVYQSELPLPSYGGRSVEL
ATAGSAAAYHAGYDAEPPSPTTGAYDSPFSFHPPAISEQQPGSFAAAPANPRKRPHPGSD
DDDGPRGVPAPGEYDYGSESRPQSRRLTVMELCNDSDADAGLRPPTGTAATATAGGGASR
PTTSSGLVSSASNLALVDRSPSGSSVFAGVTLPAIAATSPAA
Download sequence
Identical sequences XP_007765204.1.51617 jgi|Conpu1|118852|estExt_Genewise1Plus.C_2_t60043

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]