SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|120461|estExt_Genewise1Plus.C_3_t40428 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|120461|estExt_Genewise1Plus.C_3_t40428
Domain Number 1 Region: 193-459
Classification Level Classification E-value
Superfamily Adenine nucleotide alpha hydrolases-like 1.79e-52
Family N-type ATP pyrophosphatases 0.00000445
Further Details:      
 
Domain Number 2 Region: 10-209
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 2.5e-52
Family Class I glutamine amidotransferases (GAT) 0.00000499
Further Details:      
 
Domain Number 3 Region: 418-537
Classification Level Classification E-value
Superfamily GMP synthetase C-terminal dimerisation domain 5.49e-50
Family GMP synthetase C-terminal dimerisation domain 0.00000748
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|120461|estExt_Genewise1Plus.C_3_t40428
Sequence length 538
Sequence
MAEIHHQFDTILILDFGSQYSHLITRRCRELNVYAELMPCTAKISDIPFKPKGIILSGSP
YSVYDDEAPHADPAIYDLGVPILGICYGLQEITWNFGGKVSKHDHREYGFANVQITRAGG
SNGSVDALFDGLGDEMKVWMSHGDQLSELPPHFHIIGATKTAPYAAIAHDSKPFYGIQFH
PEVTHSPRGKELIGRFVLNICQCNATWTMEEFIGKEITRIREICGPKGRVIGAVSGGVDS
TVAAKLMHEAIGDRFHAIMVDNGVLRMNESKQVHEMLSRDLGVNLTIIDASERFLGLLAG
VEDPEQKRKIIGNTFIHVFEEQAARLEKEAEVEEEKGSEKGKVEWLLQGTLYPDVIESIS
FKGPSATIKTHHNVGGLLKDMKLKLIEPLRELFKDEVRALGRLLSIPAPLVQRHPFPGPG
LAIRILGPVTREQVKILQQADQIYLEEIRKAELYDNISQAFAVLLPVRAVGVMGDKRTYE
QVIALRAVQSEDFMTADWYVFPPEVLRRISSRITNEVDGINRVTYDISSKPPATVEWL
Download sequence
Identical sequences XP_007766189.1.51617 jgi|Conpu1|120461|estExt_Genewise1Plus.C_3_t40428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]