SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|120826|estExt_Genewise1Plus.C_4_t10257 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|120826|estExt_Genewise1Plus.C_4_t10257
Domain Number 1 Region: 22-167
Classification Level Classification E-value
Superfamily Osmotin, thaumatin-like protein 0.00000000000000719
Family Osmotin, thaumatin-like protein 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|120826|estExt_Genewise1Plus.C_4_t10257
Sequence length 187
Sequence
MKTFIGAALAAALVGPAAAFNINFQNNCGYTIWPAIGKAPNGVPDTSVAYGTTLGAGASA
SYSIADTEVGIRAWGRTGCDSTGANCATGNCNGGLVCTDGGITAGVILSEYGYGDYGSCC
GGDRITWDLSIVDSSININTELSSSDGQSVTCTQSSCPADQAFDNAGDSAADRNSALGVT
FTHTFCP
Download sequence
Identical sequences jgi|Conpu1|120826|estExt_Genewise1Plus.C_4_t10257 XP_007766711.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]