SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|121521|estExt_Genewise1Plus.C_4_t30070 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|121521|estExt_Genewise1Plus.C_4_t30070
Domain Number 1 Region: 1091-1355
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 1.76e-86
Family Class I glutamine amidotransferases (GAT) 0.0000000767
Further Details:      
 
Domain Number 2 Region: 675-862
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 8.37e-59
Family PurM N-terminal domain-like 0.000000395
Further Details:      
 
Domain Number 3 Region: 250-456
Classification Level Classification E-value
Superfamily PurM N-terminal domain-like 1.15e-58
Family PurM N-terminal domain-like 0.000000114
Further Details:      
 
Domain Number 4 Region: 465-647
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 6.73e-46
Family PurM C-terminal domain-like 0.00000079
Further Details:      
 
Domain Number 5 Region: 871-1082
Classification Level Classification E-value
Superfamily PurM C-terminal domain-like 3.44e-44
Family PurM C-terminal domain-like 0.000011
Further Details:      
 
Domain Number 6 Region: 1-168
Classification Level Classification E-value
Superfamily PurS-like 3.56e-32
Family FGAM synthase PurL, PurS-like domain 0.00017
Further Details:      
 
Domain Number 7 Region: 192-249
Classification Level Classification E-value
Superfamily FGAM synthase PurL, linker domain 3.01e-16
Family FGAM synthase PurL, linker domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|121521|estExt_Genewise1Plus.C_4_t30070
Sequence length 1356
Sequence
MLVLYGRSALSESRRESTLSEVKKLQPQVASIDAVYVHLVKCVSPAAEIALRDPQAPYIR
SLIHLLAYGDDAQLNTTAQALEKGEDVVYVLPRAGSISPWSSKATDIAIICNLGQHIERL
ERGVAFVVKLSGDSKLSEATVGSITHLLHDRMTQTVQLSLPHEDLVFKHQAPASLRTVEL
GRTGETVDIAQARERLSSANKELGLALASDEIDYLIDAFVSGSSPISRNPTDAELFMFAQ
VNSEHCRHKIFNASWTIDGAAKDKSLFQMIRNTEKVSPHGTISAYSDNAAVIEGPKSSRF
SCSTSLSHMYSHTSEDMPILIKVETHNHPTAVSPYPGAATGSGGEIRDEGAVGRGSKPKA
GLAGFTVSNLLIPGHEQPWETDFGRPAHIASALDIMIEGPLGASAFNNEFGRPALTGYFR
TFSEAVPATEDGQGEEIRGYHKPIMIAGGYGNVRPQFAKKTLISAGAKIVVLGGPGMLIG
LGGGAASSQVSGSSSAELDYASVQRDNAEMQRRCQQVIDACVALDVQNPLQSIHDVGAGG
LSNALPELVHDSGLGANFEIRDVLVADSSMSPMEIWCNESQERYVLAVAPEYEDSFVQIA
KRERCPFSIVGVATVEEELIVTDRLLGQDVIRLKMSTLFGKPPRMSRSDSARKVLFRPFD
SSLSTYLPSSPSISERVSSAVERVLHLPSVGSKSFLITIGDRSITGLVAREQMVGPWQVP
VADVAVTRSSYGFDVKVGEAMAMGERTPVALLKASASARMAIAESLTNLAAANVSDLSRV
KLSANWMCAASKAGEGAGLFAAVEAIGEELCPALGVGIPVGKDSMSMSMKWKQDGQQREV
SAPMSLIVTAFGSVEDIGLTWTPQLRTDVNESTVLVLFDLAGGKQRLGGSALAQVFKEIG
SEPADVEDPKVVKSFFVGCQKARQGSPDLVLAYHDRSDGGLFTTLAEMCFAGRVGAEISL
DALPSSEDPVSALLNEELGAVVQVRKSDLEKLVSTFVAANFPSTSIHVIGRVNENSKDQS
FRVIHESGLLFSSTRQQMQTSWSETSFRMQSLRDNPLSAKQEFDLINDESHSGLKYDLTF
SYQPSTVAGPSRPKVAILREQGVNGQIEMAWAFSAAGFEAVDVHMSDILSEAVSLSGFKG
LAACGGFSYGDVLGAGKGWAHSVLLNNLARKEFTDFFAREDTFALGVCNGCQFLSHLRSI
IPGADSWPDFKGNVSERFEGRTSMVEISTNEVIEASVFLRGMGGSRFPVAVAHGEGRASF
YGEDQQQRLEDGGLVALRYVDSSGTPTEIYPLNPNGSPGGITGVQTPDGRILALMPHPER
VATLESNSWYPQQFRSSWEGRGPWFKLFQNAREWVG
Download sequence
Identical sequences jgi|Conpu1|121521|estExt_Genewise1Plus.C_4_t30070 XP_007766966.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]