SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|122044|estExt_Genewise1Plus.C_4_t40165 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|122044|estExt_Genewise1Plus.C_4_t40165
Domain Number 1 Region: 355-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000287
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|122044|estExt_Genewise1Plus.C_4_t40165
Domain Number - Region: 412-432
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00378
Family Classic zinc finger, C2H2 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|122044|estExt_Genewise1Plus.C_4_t40165
Sequence length 676
Sequence
MTDTPSDENSANVLAIPSFPEGQFDGEEWGEDGDDYEDEDYEDDEDPEEIARRLNEQLLA
DISRAQAESAQASVQAGTSNNTTASTGHDPIPLLPDPSVFINEAQASASALSESNSARKH
EAAIKTMRAILDLTSGDSLARSALASTSIPNSDDNLLSALQNISSAGSVPKDLARALSHV
LVSLARSDALFANLRHSNAPAMQLDLGKRKRDDAQDPAYAQPQAMDVDSRPFKRPALAPP
DLQSQIAEAVHVVGSTLTTVPTDRPLDPALISSIQAQLHQIFLFAVTSSSGGGPEMGPLQ
EIGGLIQAIGVISGTHIGPPAPHPPHPHDPHLNPWGAPPPQHGDHLFTDLTTAVYPCLHP
ACTKTFARLYSLRAHARMHTTHRPFRCAACPAAFARNHDLKRHTHLHDRRGWQCGGCAKL
FSRRDAIKRHKNASAARADGSGAQCVEAEVREVELDREGDEEDAKEGRRARMWSDIAAVS
GAPPGGGFVPFDGGTVGGIGGPEEGEISREVVGRGQAAVMSLHGLLQARVSSALGAPVGQ
GNPLVVPPPPPQYDPSIMGGQATLASIIARAQAQPPPAVPPASAAQPIPSIEAPPVDVAG
SEQATSGGSTAQSLALLGLSEEQAKLLEQAIAHAASAAQAQAEAEAAMEEEEEDYEDDED
ATLDGEGENMAGEAGA
Download sequence
Identical sequences XP_007767214.1.51617 jgi|Conpu1|122044|estExt_Genewise1Plus.C_4_t40165

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]