SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|123377|estExt_Genewise1Plus.C_5_t40074 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|123377|estExt_Genewise1Plus.C_5_t40074
Domain Number 1 Region: 55-89,117-192
Classification Level Classification E-value
Superfamily GroES-like 0.0000000000145
Family Alcohol dehydrogenase-like, N-terminal domain 0.02
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|123377|estExt_Genewise1Plus.C_5_t40074
Domain Number - Region: 450-506
Classification Level Classification E-value
Superfamily Type II DNA topoisomerase 0.0167
Family Type II DNA topoisomerase 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|123377|estExt_Genewise1Plus.C_5_t40074
Sequence length 569
Sequence
MATVEIVRGIAGKDRSGKARANLFSVGWFSKDKSKRDHREAEVDIPLGFTAYRSPPSYVG
GNSVLVQVWAVGLDGTDARLVGLDPSPSSSSLATSPYSSDGEKFNTLKDDRIKTPSPGYT
PGRSFVGRVLETGWEVREEIIKRGEWVYGLYPVNKSGALAEFIIVDRHRIHRVPHPWMPP
AAAAPFQVSNPSRFQGGDATPEMDGKKGLTIDELALLPLIGLPAHRAVRSLAELTHTLAK
PHSLSSPTGEGSGIQERYHRAMSGVDQEIKEDMSEIGDQRVHIRPRVLILRAHDGPGALA
LKLLVRSGWSVWAHVPVPFPLPGPKESPDEETLDEKESEKDVRRSTLHAIETRLRDWGAQ
ETGSVIALQKYLSLMRVHFDAVLDTLGGREVWEAGRMLLSQPVHDKSRQDVPAQFTTTVG
DIPDRIVATAGDHFRAGVRSLRVGSGKDLNAELQEQMEALPPEIKRSKEKPRAVQYSWVN
IVSDVDWDGSDVRDTLFSVLKAALDDKILPHVTCSDFKRPNKGKGVAKRAAMSANLEGGK
VIPFENTPSVFKQGGGLEYGGTIVSRIVG
Download sequence
Identical sequences jgi|Conpu1|123377|estExt_Genewise1Plus.C_5_t40074 XP_007768103.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]