SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|127181|estExt_Genewise1Plus.C_9_t20297 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|127181|estExt_Genewise1Plus.C_9_t20297
Domain Number 1 Region: 626-684
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-19
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Domain Number 2 Region: 673-727
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000242
Family Classic zinc finger, C2H2 0.0091
Further Details:      
 
Domain Number 3 Region: 597-637
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000332
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 4 Region: 146-172
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000143
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Weak hits

Sequence:  jgi|Conpu1|127181|estExt_Genewise1Plus.C_9_t20297
Domain Number - Region: 544-568
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0643
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|127181|estExt_Genewise1Plus.C_9_t20297
Sequence length 751
Sequence
MDAEFGLSSECTDQCVVVACTDPSHPLRPCPSNHSCDDIASCSESSDCRKDDCPTLECQD
CATEPCTKCPALDDLLKCCTDYIAEHPWYTSLTDIDCCCIHSGTESHPLPVLDMLPPLSA
SQTVHLSNGPEELPHDPPNGSIRAHPCMWATCTATFGCLDELIEHVNSTHLAATAASCHW
GDCAANPDALAPHLLLHHLNIPDHAHGDGDLTRGSAYLHTTQTSNGYLNQPPHTPPDMNF
TSQPLNRSEPDMDHHRSAQYESSLYTQASPHMFPRQALHDVAPSLGQSYGHGLQRSQQNY
HHAPSPSYAFQANATHHHSAPSLQHQQYDPSLDHPFQQSQPHGAHSYAVSSTRETVEYYG
FPQHSSQPQNHHARHSPGSNETQTAMPTEVPFQAGADRSQPGVQPGYVQQQNMEYTAAQN
DVTWSAPPSAPTQGGYDQSVSSLSSSPFSSAPSPSAAVSVYASPPSLAVALQESPPPQHQ
LSPSTDDQEREVFAGLPGGAKTTPSSHAQEQPSADSIDVHECLWMTSCPLHSHPSSSHHQ
FRTWACYKTFPTSAALTQHIAEAHVGSGKARYECFWQGCNRNSGLGDGTGGSGENEGFGS
KQKIMRHIQSHTGHRPFQCSVCKQNFSEAATLQQHMRRHTKEKPYACDYPGCGKAFAITG
ALTIHKRTHFGLRPFKCTYCDKAFAESSNLAKHLRTHTGARPYVCAEPGCGKSFARPDQL
ARHGAIHRKGGPSVRPSPPDSISDVLVAVHD
Download sequence
Identical sequences jgi|Conpu1|127181|estExt_Genewise1Plus.C_9_t20297 XP_007770921.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]