SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|127721|estExt_Genewise1Plus.C_10_t10182 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|127721|estExt_Genewise1Plus.C_10_t10182
Domain Number 1 Region: 121-387
Classification Level Classification E-value
Superfamily vWA-like 3.56e-86
Family Trunk domain of Sec23/24 0.000000283
Further Details:      
 
Domain Number 2 Region: 2-61,404-510
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 4.71e-60
Family beta-sandwich domain of Sec23/24 0.0000965
Further Details:      
 
Domain Number 3 Region: 614-758
Classification Level Classification E-value
Superfamily C-terminal, gelsolin-like domain of Sec23/24 6.8e-57
Family C-terminal, gelsolin-like domain of Sec23/24 0.00000455
Further Details:      
 
Domain Number 4 Region: 511-613
Classification Level Classification E-value
Superfamily Helical domain of Sec23/24 6.93e-47
Family Helical domain of Sec23/24 0.0000055
Further Details:      
 
Domain Number 5 Region: 42-123
Classification Level Classification E-value
Superfamily Zn-finger domain of Sec23/24 6.8e-22
Family Zn-finger domain of Sec23/24 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|127721|estExt_Genewise1Plus.C_10_t10182
Sequence length 763
Sequence
MNFEDVEDRDGVRLSWNVWPSSRIEATRTVVPISALYTPLKQREDLPPVMYEPVTCKPPC
RAILNPYCQIDVRGKLWICPFCLSRNAFPPHYKDISNTNLPAELLPKYTTIEYTLSRPAP
VPPIFLFVVDTCLDEDDLKALRDALVVSLSLLPPYALVGLITFGTMTQVHELGYEHCSKS
YVFRGGKEYSSKQIQDMLGLSTAARAAPRPGQPMPQQAFGAARFLLPVQQCEFQLTGILE
ALARDPWPVANDKRALRCTGGALSVAVGLLETTFPNTGARIMLFAGGPATEGPGQVVSNE
LKEPIRSHHDIERDSVKHYKRAIKFYEGLAKRASGNGHTIDLFAGCLDQVGLLEMKSLPN
STNGAMVLSDSFATSIFKQSFLRLFNKDEQDFLQMGFNATFDVQTTKELRVSGLIGHAIS
AGKKSACVGETEIGIGQTSAWKINNITPRTSAAVYFEVVTPAGQALPPGSRGLIQFVTHY
QHASGQQRLRVTTIARNFAEAGSPSIAASFDQEASAVLMARIAVFKAEIDDSPDVLRWLD
RMLIRLCQKFADYRKEDPASFRLSDNFSIYPQFMFHLRRSQFLQVFNNSPDETAFYRHIL
NEEDVNNSLIAIQPTLMSYTFDVPPQPVLLDSVSIKPDVILLLDTFFHILIFHGETVAQW
RKAGYQEQEGYENFKELLEAPVADAQDLLGDRFPIPRYIVCDQGGSQARFLLSKLNPSTT
HMSTGMYGSAAGQGAGQAIFTDDVSLQVFMEHLKRLAVGAQTN
Download sequence
Identical sequences XP_007771283.1.51617 jgi|Conpu1|127721|estExt_Genewise1Plus.C_10_t10182

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]