SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|129795|estExt_Genewise1Plus.C_13_t10013 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  jgi|Conpu1|129795|estExt_Genewise1Plus.C_13_t10013
Domain Number - Region: 16-42
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0384
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|129795|estExt_Genewise1Plus.C_13_t10013
Sequence length 993
Sequence
MSFLSNPSEGRTWGRYDCRVPGCGAEIASKSGLTQHTNRVHRRIIRSRRFHQPAPASVPS
SVPPPPVQHHSQSLPVRQPPQDPQDHSPPRTSSPPSFDFFLPYKCPPITFSSASKCNVHG
EYVSPSSQPDLPPPRSPSDWFPFNNQVEFETADLLYRRVQMSATHIDALLAVWGASLTKE
DGSELPPPFLDHDKMYKAIDKIEHCDVAWETFNVSYQGPRPSQNIPTWMDGKYDVWFRDP
REVIKNILSRPDMKDDIDLTPYRDYDEAGVRQYENMFSGDWAWDQATRISEDPSTHGATF
VPFIMGSDKTTVSVATGATEYYPLYISPGNIHNTARRARRNAVALVGFLSVPKADESCAD
DPQFRHFRRQLYHTSLSTILQAFKPGMTQPEVVLFGDGHYRRVVWGVGPYIADYPEQVLL
AGIVQGWCPRCLAFPDRLDDHALRRCQEHTEALIEEYHPGVLWSSYGIIANVVPFTNDFP
RADIHELIAPDLLHQLIKGTFKDHLVEWVCRYLKSQHTRRDYKKIMADIDRRIAVAAPFA
GLRRFPQGRGFKQWTGDDSKALMKVYLPAIENHVPDGMVRAVRAFLEFCYLVRRNTLTDT
DITALQRALDSFHHHRESFRDFGVTLSLPRQHSLVHYIYLVQQFGAPNGLCSSITESKHI
EAVKEPWRRSSRFNALGQMLTTNQRLDKLKAARVDFAARGMLNSSVLPRRLRMLQTLDAQ
DSSQDTQHAEPNTTNGLQVYEPVSCSVQATEEQEEPEVDGTTITAEVNLAAKSNTQRARD
FDALAAEISVQNIRRLTRRFLYAQLHPDITRRTARSVRPQDLPNLPETLRVYDSAVSIYR
APSDLCGSGGLKRERIRSTPLWRNEAPRNDCAFVVTRPDVDGIFSMEVARILAFFSFRYE
GCVYPCAVVHWYNWDGDERDENTGMYVVRPSMTASNSRHVEVVHVDSLVRGAHLLPVFGG
QLIPKDMKCYHSLDSFEAFYVNRFADHHAYELA
Download sequence
Identical sequences jgi|Conpu1|129795|estExt_Genewise1Plus.C_13_t10013 XP_007772956.1.51617

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]