SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for jgi|Conpu1|131045|estExt_Genewise1Plus.C_14_t20223 from Coniophora puteana

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  jgi|Conpu1|131045|estExt_Genewise1Plus.C_14_t20223
Domain Number 1 Region: 3-183
Classification Level Classification E-value
Superfamily Class I glutamine amidotransferase-like 7.64e-21
Family DJ-1/PfpI 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) jgi|Conpu1|131045|estExt_Genewise1Plus.C_14_t20223
Sequence length 268
Sequence
MPSVLIPMADYGHDPTEVAIPYSVFKAAGFTVDFATETGKTPECDRKMLKGITGTLLGAD
AKAKAAYADMAATSASFKSPKAWTDPAFSLDEYDLVMLPGGHDKGVRQVIDSKAIHDHLA
RFFPGTSRSTDGAKKTVAAICHGVQILALETAKIDTDLSASYKSIIHACATTALPSFMET
SIYNTTRLFLGDYYKTYGACTPNVEDYVKCGLDNPEKQFSAGPGMLGGKMNEPFIVEDEG
FRYVSGRFPPDAERLAERLQGLRKHVLS
Download sequence
Identical sequences XP_007773655.1.51617 jgi|Conpu1|131045|estExt_Genewise1Plus.C_14_t20223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]